PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC1426_p4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family SBP
Protein Properties Length: 358aa    MW: 40081.1 Da    PI: 9.6389
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC1426_p4genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP123.49.9e-3958135178
                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                 +CqvegC++dl++ak+y++rhkvC +hsk+++v+vsgl qrfCqqCsrfh+lsefD ekrsCrrrL  hnerrrk+qa
  RrC1426_p4  58 RCQVEGCRMDLNNAKRYYSRHKVCCIHSKSSKVIVSGLLQRFCQQCSRFHKLSEFDLEKRSCRRRLTCHNERRRKPQA 135
                 6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.1E-3051120IPR004333Transcription factor, SBP-box
PROSITE profilePS5114130.52256133IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.66E-3657137IPR004333Transcription factor, SBP-box
PfamPF031102.8E-2859132IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MELLTGSGQN RTETVGSSST ESSSLTTGLR FGQKIYLEDG SGSRLSKNRG RKSTTTARCQ  60
VEGCRMDLNN AKRYYSRHKV CCIHSKSSKV IVSGLLQRFC QQCSRFHKLS EFDLEKRSCR  120
RRLTCHNERR RKPQATTASL YGSILGDPTT WSTARDSHQL MNALSQGSSS FSITYPEMVN  180
NNNSRESSCA LSLLSNSNTT QQQQQQQLQT SINDSLRVTM AQSPPVSTVH SQYTNQTWGF  240
MSGKKSNSPC VSPVLGLSQI SEPDELRFLM SNGTTMGGFE LNLQQQVLRQ YLEPDDSRAY  300
LHSIVAYQMI LKNIRNNVES QLLKNVASYF YFLLLFFSSI VTGSTLPDPH LPRADTGL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-27591321184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0863841e-91AY086384.1 Arabidopsis thaliana clone 247919 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013636721.11e-146PREDICTED: squamosa promoter-binding-like protein 15
RefseqXP_013688040.11e-146PREDICTED: squamosa promoter-binding-like protein 15
SwissprotQ9M2Q61e-123SPL15_ARATH; Squamosa promoter-binding-like protein 15
TrEMBLA0A078ICR61e-146A0A078ICR6_BRANA; BnaC04g23930D protein
TrEMBLA0A0D3BX541e-146A0A0D3BX54_BRAOL; Uncharacterized protein
STRINGfgenesh2_kg.5__2235__AT3G57920.11e-128(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21442775
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57920.11e-112squamosa promoter binding protein-like 15